PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.2983s0029.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 746aa    MW: 81653.1 Da    PI: 5.6355
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.2983s0029.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.21.6e-1963118156
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          +++ +++t+ q++eLe++F+++++p+ ++r+eL++ l+L+  qVk+WFqN+R+++k
  Bostr.2983s0029.1.p  63 KKRYHRHTQRQIQELESFFKECPHPDDKQRKELSRDLNLEPLQVKFWFQNKRTQMK 118
                          688999***********************************************998 PP

2START216.78e-682534741206
                          HHHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
                START   1 elaeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                          ela +a++e+ ++a a++p+Wv+     e++n++e+ ++f+++ +      ++ea+r+s+vv+m++ +lve+l+d++ qW+  +     +
  Bostr.2983s0029.1.p 253 ELAVAAMEEFWRMAHAGDPLWVSTDnsiEILNEEEYFRTFPRGIGpkplgLRSEASRESAVVIMNHINLVEILMDVN-QWSCVFSgivsR 341
                          57899******************99999**************999********************************.************ PP

                          EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE..TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTC CS
                START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvdseqkppesssvvRaellpSgiliepksng 160
                          a tlev+s+g      galq+m+ae+q++splvp R+ +fvRy++q +++g+w++vdvS+ds ++ +   ++ R +++pSg+li++++ng
  Bostr.2983s0029.1.p 342 ALTLEVLSTGvagnynGALQVMTAEFQVPSPLVPtRENYFVRYCKQhDSDGSWAVVDVSLDSLRPST---PILRTRRRPSGCLIQEMPNG 428
                          ****************************************************************976...7******************* PP

                          EEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 161 hskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                          +skvtw+eh+++++r++h+++++lv+sgla+gak+wvatl+rqce+
  Bostr.2983s0029.1.p 429 YSKVTWIEHMEVDDRSVHNMYKPLVHSGLAFGAKRWVATLERQCER 474
                          ********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.9E-2443118IPR009057Homeodomain-like
SuperFamilySSF466897.94E-1949120IPR009057Homeodomain-like
PROSITE profilePS5007116.95760120IPR001356Homeobox domain
SMARTSM003891.0E-1761124IPR001356Homeobox domain
PfamPF000463.7E-1763118IPR001356Homeobox domain
CDDcd000863.60E-1863121No hitNo description
PROSITE patternPS00027095118IPR017970Homeobox, conserved site
PROSITE profilePS5084843.863244477IPR002913START domain
SuperFamilySSF559615.63E-35246476No hitNo description
CDDcd088751.94E-123248473No hitNo description
SMARTSM002342.0E-75253474IPR002913START domain
PfamPF018521.1E-56254474IPR002913START domain
Gene3DG3DSA:3.30.530.202.8E-6350474IPR023393START-like domain
SuperFamilySSF559611.22E-25494733No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009913Biological Processepidermal cell differentiation
GO:0048497Biological Processmaintenance of floral organ identity
GO:0048825Biological Processcotyledon development
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 746 aa     Download sequence    Send to blast
MYHPNMFESH HMFDMTPKST SDNDLGITGS REDDFETKSG TDVTTENPSG EELQDPNQRP  60
NKKKRYHRHT QRQIQELESF FKECPHPDDK QRKELSRDLN LEPLQVKFWF QNKRTQMKAQ  120
SERHENQILK SDNDKLRAEN NRYKEALSNA TCPNCGGPAA IGEMSFDEQH LRIENARLRE  180
EIDRISAIAA KYVGKPSGSS FAPLAIHAPP RSLDLEVGNF GNQTGFVGEM YGTGDILRSV  240
SIPSETDKPI IVELAVAAME EFWRMAHAGD PLWVSTDNSI EILNEEEYFR TFPRGIGPKP  300
LGLRSEASRE SAVVIMNHIN LVEILMDVNQ WSCVFSGIVS RALTLEVLST GVAGNYNGAL  360
QVMTAEFQVP SPLVPTRENY FVRYCKQHDS DGSWAVVDVS LDSLRPSTPI LRTRRRPSGC  420
LIQEMPNGYS KVTWIEHMEV DDRSVHNMYK PLVHSGLAFG AKRWVATLER QCERLASSMA  480
NNIPGDLSAV ITSPEGRKSM LKLAERMVMS FCSGVGASTA HAWTTMSTTG SDDVRVMTRK  540
SMDDPGRPPG IVLSAATSFW IPVAPKRVFD FLRDENSRKE WDILSNGGMV QEMAHIANGH  600
EPGNCVSLLR VNSGNSSQSN MLILQESCTD ASGSYVIYAP VDIVAMNVVL SGGDPDYVAL  660
LPSGFAILPD GSVGGGDGNP QEVVSSTSSG SCGGSLLTVA FQILVDSVPT AKLSLGSVAT  720
VNSLIKCTVE RIKAAVACDG GGGGA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4245600.0AF424560.1 Arabidopsis thaliana AT4g04890/T1J1_3 mRNA, complete cds.
GenBankAY0625750.0AY062575.1 Arabidopsis thaliana Unknown protein (At4g04890; T1J1.3) mRNA, complete cds.
GenBankBT0001440.0BT000144.1 Arabidopsis thaliana Unknown protein (At4g04890) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010455802.10.0PREDICTED: homeobox-leucine zipper protein PROTODERMAL FACTOR 2 isoform X3
RefseqXP_010455800.10.0PREDICTED: homeobox-leucine zipper protein PROTODERMAL FACTOR 2 isoform X2
RefseqXP_010455799.10.0PREDICTED: homeobox-leucine zipper protein PROTODERMAL FACTOR 2 isoform X1
RefseqXP_010455798.10.0PREDICTED: homeobox-leucine zipper protein PROTODERMAL FACTOR 2 isoform X1
SwissprotQ93V990.0PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLR0FD460.0R0FD46_9BRAS; Uncharacterized protein
STRINGAT4G04890.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49128149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2